eF-site ID 2bo7-J PDB Code 2bo7 Chain J click to enlarge Title DISSECTION OF MANNOSYLGLYCERATE SYNTHASE: AN ARCHETYPAL MANNOSYLTRANSFERASE Classification TRANSFERASE Compound MANNOSYLGLYCERATE SYNTHASE Source (Q9RFR0_RHOMR) Sequence J:  SLVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQ TYEAVERAAPEISRATGTPVSVRLQERLGTLRPGKGDGMN TALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFG YGLVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQ PLGGELLMRREVAAMLYEDERVRRRSDWGIDTLYTFVTVQ QGVSIYECYIPEGKAHRLDLRTMLVECFAAIQSLQHEVVG QPAIHRQEHPHRVPVHIAERVGYDVEATLHRLMQHWTPRQ VELLELFTTPVREGLRTCQRRPAFNFMDEMAWAATYHVLL EHFQPGDPDWEELLFKLWTTRVLNYTMTVALRGYDYAQQY LYRMLGRYRYQAALEN Description Functional site 1) chain J residue 102 type sequence D description BINDING SITE FOR RESIDUE CO J1384 source : BC1 2) chain J residue 217 type sequence H description BINDING SITE FOR RESIDUE CO J1384 source : BC1 3) chain J residue 7 type sequence P description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 4) chain J residue 8 type sequence F description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 5) chain J residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 6) chain J residue 11 type sequence E description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 7) chain J residue 35 type sequence I description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 8) chain J residue 37 type sequence Y description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 9) chain J residue 66 type sequence Q description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 10) chain J residue 75 type sequence G description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 11) chain J residue 76 type sequence K description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 12) chain J residue 100 type sequence D description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 13) chain J residue 101 type sequence A description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 14) chain J residue 102 type sequence D description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 15) chain J residue 189 type sequence W description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 16) chain J residue 217 type sequence H description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 17) chain J residue 218 type sequence R description BINDING SITE FOR RESIDUE GDP J1383 source : CC2 18) chain J residue 7 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 19) chain J residue 35 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 20) chain J residue 66 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 21) chain J residue 76 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 22) chain J residue 100 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 23) chain J residue 102 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 24) chain J residue 131 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 25) chain J residue 136 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 26) chain J residue 163 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 27) chain J residue 192 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 28) chain J residue 217 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain J residue 218 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links