eF-site ID 2bck-A PDB Code 2bck Chain A click to enlarge Title Crystal Structure of HLA-A*2402 Complexed with a telomerase peptide Classification IMMUNE SYSTEM Compound HLA class I histocompatibility antigen, A-24 alpha chain Source Homo sapiens (Human) (TERT_HUMAN) Sequence A:  GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDA ASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDG KDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYL EGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGT FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPGSGG GLNDIF Description Functional site 1) chain A residue 79 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 2) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 3) chain A residue 21 type sequence R description BINDING SITE FOR RESIDUE SO4 B 303 source : AC3 4) chain A residue 275 type sequence E description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 5) chain A residue 276 type sequence P description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 6) chain A residue 277 type sequence G description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 7) chain A residue 278 type sequence S description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 8) chain A residue 279 type sequence G description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 9) chain A residue 280 type sequence G description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 10) chain A residue 281 type sequence G description BINDING SITE FOR RESIDUE SO4 A 307 source : AC7 11) chain A residue 147 type sequence W description BINDING SITE FOR RESIDUE SO4 A 308 source : AC8 12) chain A residue 150 type sequence A description BINDING SITE FOR RESIDUE SO4 A 308 source : AC8 13) chain A residue 8 type sequence F description BINDING SITE FOR RESIDUE GOL A 309 source : AC9 14) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE GOL A 309 source : AC9 15) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE GOL A 309 source : AC9 16) chain A residue 204 type sequence W description BINDING SITE FOR RESIDUE GOL B 204 source : BC3 17) chain A residue 242 type sequence Q description BINDING SITE FOR RESIDUE GOL B 204 source : BC3 18) chain A residue 257-263 type prosite sequence YTCHVQH description IG_MHC Immunoglobulins and major histocompatibility complex proteins signature. YTCHVQH source prosite : PS00290 19) chain A residue 84 type MOD_RES sequence Y description Pyrrolidone carboxylic acid; in form pI 5.3 => ECO:0000269|PubMed:7554280 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 143 type MOD_RES sequence T description Pyrrolidone carboxylic acid; in form pI 5.3 => ECO:0000269|PubMed:7554280 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 146 type MOD_RES sequence K description Pyrrolidone carboxylic acid; in form pI 5.3 => ECO:0000269|PubMed:7554280 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 171 type MOD_RES sequence Y description Pyrrolidone carboxylic acid; in form pI 5.3 => ECO:0000269|PubMed:7554280 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 86 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:19159218 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links