eF-site ID 2b8p-AB PDB Code 2b8p Chain A, B click to enlarge Title Crystal structure of Acanthamoeba polyphaga mimivirus NDK, the first viral nucleoside diphosphate kinase Classification TRANSFERASE Compound Probable nucleoside diphosphate kinase Source null (NDK_MIMIV) Sequence A:  YKKAGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSM KFWSKAPRNLIEQHYKEYFNDNCDFMVSGPIISIVYEGTD AISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSA VDEISIWFP B:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 3) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 4) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 5) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 6) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE SO4 A 5000 source : AC1 7) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE SO4 B 5001 source : AC2 8) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE SO4 B 5001 source : AC2 9) chain B residue 99 type sequence R description BINDING SITE FOR RESIDUE SO4 B 5001 source : AC2 10) chain B residue 109 type sequence N description BINDING SITE FOR RESIDUE SO4 B 5001 source : AC2 11) chain B residue 112 type sequence H description BINDING SITE FOR RESIDUE SO4 B 5001 source : AC2 12) chain A residue 91 type sequence N description BINDING SITE FOR RESIDUE SO4 A 5002 source : AC3 13) chain A residue 92 type sequence I description BINDING SITE FOR RESIDUE SO4 A 5002 source : AC3 14) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE SO4 A 5002 source : AC3 15) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE SO4 A 5002 source : AC3 16) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE SO4 B 5003 source : AC4 17) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE SO4 B 5003 source : AC4 18) chain B residue 56 type sequence Q description BINDING SITE FOR RESIDUE SO4 B 5003 source : AC4 19) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE SO4 B 5003 source : AC4 20) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 21) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 22) chain B residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 28) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 29) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 30) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 31) chain B residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 32) chain B residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links