eF-site ID 2b5e-A PDB Code 2b5e Chain A click to enlarge Title Crystal Structure of Yeast Protein Disulfide Isomerase Classification ISOMERASE Compound Protein disulfide-isomerase Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (PDI_YEAST) Sequence A:  MQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWC GHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHN IPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQP AVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSMA NKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKA DIADADVFEKWLQVEALPYFGEIDGSVFAQYVESGLPLGY LFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGRH AGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDK IVLESKAIESLVKDFLKGDASPIVKSQEIFENQDSSVFQL VGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELAD TYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKK SESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEKA AEE Description (1)  Protein disulfide-isomerase (E.C.5.3.4.1) Functional site 1) chain A residue 123 type sequence E description BINDING SITE FOR RESIDUE BA A 1 source : AC1 2) chain A residue 194 type sequence E description BINDING SITE FOR RESIDUE BA A 1 source : AC1 3) chain A residue 272 type sequence E description BINDING SITE FOR RESIDUE GOL A 523 source : AC2 4) chain A residue 344 type sequence L description BINDING SITE FOR RESIDUE GOL A 523 source : AC2 5) chain A residue 345 type sequence E description BINDING SITE FOR RESIDUE GOL A 523 source : AC2 6) chain A residue 346 type sequence S description BINDING SITE FOR RESIDUE GOL A 523 source : AC2 7) chain A residue 99 type sequence E description BINDING SITE FOR RESIDUE GOL A 524 source : AC3 8) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE GOL A 524 source : AC3 9) chain A residue 119 type sequence S description BINDING SITE FOR RESIDUE GOL A 524 source : AC3 10) chain A residue 61 type ACT_SITE sequence C description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 64 type ACT_SITE sequence C description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 406 type ACT_SITE sequence C description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 409 type ACT_SITE sequence C description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 62 type SITE sequence G description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 63 type SITE sequence H description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 407 type SITE sequence G description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 408 type SITE sequence H description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 126 type SITE sequence R description Lowers pKa of C-terminal Cys of first active site => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 471 type SITE sequence R description Lowers pKa of C-terminal Cys of second active site => ECO:0000250 source Swiss-Prot : SWS_FT_FI4 20) chain A residue 82 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 21) chain A residue 117 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 22) chain A residue 155 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 23) chain A residue 174 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 24) chain A residue 425 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 25) chain A residue 53-71 type prosite sequence LAEFFAPWCGHCKNMAPEY description THIOREDOXIN_1 Thioredoxin family active site. LAeFFapWCGHCKnMapeY source prosite : PS00194 26) chain A residue 398-416 type prosite sequence LVLYYAPWCGHCKRLAPTY description THIOREDOXIN_1 Thioredoxin family active site. LAeFFapWCGHCKnMapeY source prosite : PS00194

Display surface Download Links