eF-site ID 2axt-i PDB Code 2axt Chain i click to enlarge Title Crystal Structure of Photosystem II from Thermosynechococcus elongatus Classification ELECTRON TRANSPORT Compound Photosystem Q(B) protein Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence i:  METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK Description (1)  Photosystem Functional site 1) chain i residue 5009 type sequence Y description BINDING SITE FOR RESIDUE CLA a 5563 source : JC2 2) chain i residue 5013 type sequence T description BINDING SITE FOR RESIDUE CLA a 5563 source : JC2 3) chain i residue 5015 type sequence F description BINDING SITE FOR RESIDUE CLA a 5563 source : JC2 4) chain i residue 5023 type sequence F description BINDING SITE FOR RESIDUE CLA c 5495 source : LC6 5) chain i residue 5024 type sequence L description BINDING SITE FOR RESIDUE CLA c 5496 source : LC7 6) chain i residue 5015 type sequence F description BINDING SITE FOR RESIDUE BCR a 5566 source : NC2 7) chain i residue 5020 type sequence V description BINDING SITE FOR RESIDUE BCR c 5506 source : OC3 8) chain i residue 5023 type sequence F description BINDING SITE FOR RESIDUE BCR c 5506 source : OC3 9) chain i residue 5024 type sequence L description BINDING SITE FOR RESIDUE BCR c 5506 source : OC3 10) chain i residue 5005 type sequence K description BINDING SITE FOR RESIDUE MGE i 5201 source : OC4 11) chain i residue 5009 type sequence Y description BINDING SITE FOR RESIDUE MGE i 5201 source : OC4

Display surface Download Links