eF-site ID 2axt-h PDB Code 2axt Chain h click to enlarge Title Crystal Structure of Photosystem II from Thermosynechococcus elongatus Classification ELECTRON TRANSPORT Compound Photosystem Q(B) protein Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence h:  ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVF LLIILEIYNSTLILDGVNVSWKAL Description (1)  Photosystem Functional site 1) chain h residue 5041 type sequence F description BINDING SITE FOR RESIDUE CLA b 5511 source : JC4 2) chain h residue 5038 type sequence F description BINDING SITE FOR RESIDUE CLA b 5512 source : JC5 3) chain h residue 5041 type sequence F description BINDING SITE FOR RESIDUE CLA b 5512 source : JC5 4) chain h residue 5045 type sequence I description BINDING SITE FOR RESIDUE CLA b 5512 source : JC5 5) chain h residue 5046 type sequence L description BINDING SITE FOR RESIDUE CLA b 5512 source : JC5 6) chain h residue 5049 type sequence Y description BINDING SITE FOR RESIDUE CLA b 5512 source : JC5 7) chain h residue 5038 type sequence F description BINDING SITE FOR RESIDUE CLA b 5513 source : JC6 8) chain h residue 5039 type sequence L description BINDING SITE FOR RESIDUE CLA b 5513 source : JC6 9) chain h residue 5043 type sequence L description BINDING SITE FOR RESIDUE CLA b 5518 source : KC2 10) chain h residue 5046 type sequence L description BINDING SITE FOR RESIDUE CLA b 5518 source : KC2 11) chain h residue 5027 type sequence T description BINDING SITE FOR RESIDUE CLA b 5519 source : KC3 12) chain h residue 5028 type sequence T description BINDING SITE FOR RESIDUE CLA b 5519 source : KC3 13) chain h residue 5031 type sequence M description BINDING SITE FOR RESIDUE CLA b 5519 source : KC3 14) chain h residue 5034 type sequence F description BINDING SITE FOR RESIDUE CLA b 5519 source : KC3 15) chain h residue 5014 type sequence L description BINDING SITE FOR RESIDUE CLA b 5525 source : KC9 16) chain h residue 5005 type sequence T description BINDING SITE FOR RESIDUE CLA b 5526 source : LC1 17) chain h residue 5007 type sequence L description BINDING SITE FOR RESIDUE CLA b 5526 source : LC1 18) chain h residue 5038 type sequence F description BINDING SITE FOR RESIDUE BCR h 5107 source : NC7 19) chain h residue 5041 type sequence F description BINDING SITE FOR RESIDUE BCR h 5107 source : NC7 20) chain h residue 5049 type sequence Y description BINDING SITE FOR RESIDUE DGD h 5208 source : PC2 21) chain h residue 5060 type sequence V description BINDING SITE FOR RESIDUE DGD h 5208 source : PC2 22) chain h residue 5061 type sequence S description BINDING SITE FOR RESIDUE DGD h 5208 source : PC2 23) chain h residue 5062 type sequence W description BINDING SITE FOR RESIDUE DGD h 5208 source : PC2

Display surface Download Links