eF-site ID 2axt-J PDB Code 2axt Chain J click to enlarge Title Crystal Structure of Photosystem II from Thermosynechococcus elongatus Classification ELECTRON TRANSPORT Compound Photosystem Q(B) protein Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence J:  RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL Description (1)  Photosystem Functional site 1) chain J residue 21 type sequence V description BINDING SITE FOR RESIDUE BCR D 357 source : GC1 2) chain J residue 25 type sequence V description BINDING SITE FOR RESIDUE BCR D 357 source : GC1 3) chain J residue 14 type sequence A description BINDING SITE FOR RESIDUE BCR X 130 source : GC2 4) chain J residue 15 type sequence T description BINDING SITE FOR RESIDUE BCR X 130 source : GC2 5) chain J residue 18 type sequence G description BINDING SITE FOR RESIDUE BCR X 130 source : GC2 6) chain J residue 19 type sequence M description BINDING SITE FOR RESIDUE BCR X 130 source : GC2 7) chain J residue 33 type sequence Y description BINDING SITE FOR RESIDUE DGD C 508 source : HC1 8) chain J residue 29 type sequence F description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 9) chain J residue 32 type sequence A description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 10) chain J residue 33 type sequence Y description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 11) chain J residue 37 type sequence G description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 12) chain J residue 38 type sequence S description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 13) chain J residue 39 type sequence S description BINDING SITE FOR RESIDUE DGD C 509 source : HC2 14) chain J residue 31 type sequence G description BINDING SITE FOR RESIDUE MGE D 358 source : HC3 15) chain J residue 32 type sequence A description BINDING SITE FOR RESIDUE MGE D 358 source : HC3 16) chain J residue 35 type sequence G description BINDING SITE FOR RESIDUE MGE D 358 source : HC3 17) chain J residue 37 type sequence G description BINDING SITE FOR RESIDUE MGE D 358 source : HC3

Display surface Download Links