eF-site ID 2axh-A
PDB Code 2axh
Chain A

click to enlarge
Title Crystal structures of T cell receptor beta chains related to rheumatoid arthritis
Classification IMMUNE SYSTEM
Compound T cell receptor beta chain
Source Homo sapiens (Human) (TCB_HUMAN)
Sequence A:  DGGITQSPKYLFRKEGQNVTLSCEQNLNHDAXYWYRQDPG
QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTS
AQKNPTAFYLCASSIGQXNEQYFGPGTRLTVLEDLKNVFP
PEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN
GKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQ
NPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
AD
Description (1)  T cell receptor beta chain

Display surface

Download
Links