eF-site ID 2av4-A PDB Code 2av4 Chain A click to enlarge Title Crystal structure of Plasmodium yoelii thioredoxin-like protein 4A (DIM1) Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION Compound Thioredoxin-like protein 4A (DIM1) Source Plasmodium yoelii yoelii (Q7R866_PLAYO) Sequence A:  HHMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKM DELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSV MFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIFR GARKGRGLVISPKDY Description Functional site 1) chain A residue 24 type sequence Q description BINDING SITE FOR RESIDUE CL A 1000 source : AC1 2) chain A residue 30 type sequence W description BINDING SITE FOR RESIDUE CL A 1000 source : AC1 3) chain A residue 27 type sequence N description BINDING SITE FOR RESIDUE CL A 1001 source : AC2 4) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE CL A 1001 source : AC2 5) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE CL A 1001 source : AC2 6) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE CL A 1001 source : AC2 7) chain A residue 145 type sequence R description BINDING SITE FOR RESIDUE CL A 1002 source : AC3 8) chain A residue 146 type sequence G description BINDING SITE FOR RESIDUE CL A 1002 source : AC3 9) chain A residue 147 type sequence L description BINDING SITE FOR RESIDUE CL A 1002 source : AC3 10) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE CL A 1003 source : AC4

Display surface Download Links