eF-site ID 2aus-D PDB Code 2aus Chain D click to enlarge Title Crystal structure of the archaeal box H/ACA sRNP Nop10-Cbf5 complex Classification ISOMERASE/STRUCTURAL PROTEIN Compound pseudouridine synthase Source Pyrococcus abyssi (strain GE5 / Orsay) (NOP10_PYRAB) Sequence D:  RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGE YRRRLKRELLGIG Description Functional site 1) chain D residue 8 type sequence C description BINDING SITE FOR RESIDUE ZN D 1071 source : AC2 2) chain D residue 11 type sequence C description BINDING SITE FOR RESIDUE ZN D 1071 source : AC2 3) chain D residue 20 type sequence C description BINDING SITE FOR RESIDUE ZN D 1071 source : AC2 4) chain D residue 23 type sequence C description BINDING SITE FOR RESIDUE ZN D 1071 source : AC2 5) chain D residue 43 type sequence E description BINDING SITE FOR RESIDUE PO4 D 1001 source : AC3 6) chain D residue 46 type sequence R description BINDING SITE FOR RESIDUE PO4 D 1001 source : AC3 7) chain D residue 50 type sequence R description BINDING SITE FOR RESIDUE PO4 D 1001 source : AC3

Display surface Download Links