eF-site ID 2asq_9-A PDB Code 2asq Model 9 Chain A click to enlarge Title Solution Structure of SUMO-1 in Complex with a SUMO-binding Motif (SBM) Classification PROTEIN BINDING Compound Small ubiquitin-related modifier 1 Source Homo sapiens (Human) (PIAS2_HUMAN) Sequence A:  YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG Description Functional site 1) chain A residue 23 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI9 2) chain A residue 39 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI9 3) chain A residue 45 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI9 4) chain A residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI9 5) chain A residue 25 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) source Swiss-Prot : SWS_FT_FI10 6) chain A residue 37 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:25755297, ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI11 7) chain A residue 32 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 97 type CROSSLNK sequence G description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) => ECO:0000269|PubMed:27068747 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links