eF-site ID 2air-H
PDB Code 2air
Chain H

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source Escherichia coli (strain K12) (PYRI_ECOLI)
Sequence H:  MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQ
RITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQ
ATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEP
VSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain H
residue 109
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

2) chain H
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

3) chain H
residue 138
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

4) chain H
residue 141
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

5) chain H
residue 110
type METAL
ligand
sequence P
description Zinc
source Swiss-Prot : SWS_FT_FI2

6) chain H
residue 115
type METAL
ligand
sequence I
description Zinc
source Swiss-Prot : SWS_FT_FI2

7) chain H
residue 139
type METAL
ligand
sequence K
description Zinc
source Swiss-Prot : SWS_FT_FI2

8) chain H
residue 142
type METAL
ligand
sequence E
description Zinc
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links