eF-site ID 2air-G
PDB Code 2air
Chain G

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source Escherichia coli (strain K12) (PYRI_ECOLI)
Sequence G:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK
HKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTS
LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG
NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMV
GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILD
MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY
ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
PHAWYFQQAGNGIFARQALLALVLNRDLVL
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

2) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

3) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

4) chain G
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

5) chain G
residue 229
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

6) chain G
residue 51
type
ligand
sequence A
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

7) chain G
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

8) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

9) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

10) chain G
residue 80
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

11) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

12) chain G
residue 50-55
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence EASTRT
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_G_804

13) chain G
residue 105
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence R
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_G_804

14) chain G
residue 229
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence R
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_G_804

15) chain G
residue 268
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence P
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_G_804

16) chain G
residue 54-55
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence RT
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

17) chain G
residue 105
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence R
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

18) chain G
residue 127
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence A
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

19) chain G
residue 134
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence H
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

20) chain G
residue 137
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence Q
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

21) chain G
residue 229
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence R
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

22) chain G
residue 266
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence P
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_G_803

23) chain G
residue 54
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

24) chain G
residue 134
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

25) chain G
residue 105
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

26) chain G
residue 55
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1at1
source CSA : CSA2


Display surface

Download
Links