eF-site ID 2air-G
PDB Code 2air
Chain G

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source (PYRI_ECOLI)
Sequence G:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK
HKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTS
LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG
NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMV
GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILD
MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY
ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
PHAWYFQQAGNGIFARQALLALVLNRDLVL
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

2) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

3) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

4) chain G
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

5) chain G
residue 229
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

6) chain G
residue 51
type
ligand
sequence A
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

7) chain G
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

8) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

9) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

10) chain G
residue 80
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

11) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

12) chain G
residue 48-55
type prosite
ligand
sequence FFEASTRT
description Aspartate and ornithine carbamoyltransferases signature.F-x-[EK]-x-S-[GT]-R-T.
source prosite : PS00097

13) chain G
residue 54
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

14) chain G
residue 134
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

15) chain G
residue 105
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

16) chain G
residue 55
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1at1
source CSA : CSA2


Display surface

Download
Links