eF-site ID 2air-B
PDB Code 2air
Chain B

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source Escherichia coli (strain K12) (PYRI_ECOLI)
Sequence B:  MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQ
RITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQ
ATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEP
VSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain B
residue 109
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

2) chain B
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

3) chain B
residue 138
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

4) chain B
residue 141
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

5) chain B
residue 110
type METAL
ligand
sequence P
description Zinc
source Swiss-Prot : SWS_FT_FI1

6) chain B
residue 115
type METAL
ligand
sequence I
description Zinc
source Swiss-Prot : SWS_FT_FI1

7) chain B
residue 139
type METAL
ligand
sequence K
description Zinc
source Swiss-Prot : SWS_FT_FI1

8) chain B
residue 142
type METAL
ligand
sequence E
description Zinc
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links