eF-site ID 2air-ABGH
PDB Code 2air
Chain A, B, G, H

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source (PYRI_ECOLI)
Sequence A:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK
HKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTS
LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG
NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMV
GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILD
MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY
ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
PHAWYFQQAGNGIFARQALLALVLNRDLVL
B:  MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQ
RITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQ
ATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEP
VSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
G:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK
HKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTS
LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG
NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMV
GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILD
MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY
ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
PHAWYFQQAGNGIFARQALLALVLNRDLVL
H:  MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQ
RITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQ
ATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEP
VSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain B
residue 109
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

2) chain B
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

3) chain B
residue 138
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

4) chain B
residue 141
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 800
source : AC1

5) chain H
residue 109
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

6) chain H
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

7) chain H
residue 138
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

8) chain H
residue 141
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 801
source : AC2

9) chain A
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

10) chain A
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

11) chain A
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

12) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

13) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

14) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

15) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

16) chain G
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

17) chain G
residue 229
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP G 803
source : AC4

18) chain G
residue 51
type
ligand
sequence A
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

19) chain G
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

20) chain G
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

21) chain G
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

22) chain G
residue 80
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

23) chain G
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 G 804
source : AC5

24) chain A
residue 51
type
ligand
sequence A
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

25) chain A
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

26) chain A
residue 53
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

27) chain A
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

28) chain A
residue 80
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

29) chain A
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

30) chain A
residue 48-55
type prosite
ligand
sequence FFEASTRT
description Aspartate and ornithine carbamoyltransferases signature.F-x-[EK]-x-S-[GT]-R-T.
source prosite : PS00097

31) chain G
residue 48-55
type prosite
ligand
sequence FFEASTRT
description Aspartate and ornithine carbamoyltransferases signature.F-x-[EK]-x-S-[GT]-R-T.
source prosite : PS00097

32) chain A
residue 54
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

33) chain A
residue 134
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

34) chain A
residue 105
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

35) chain A
residue 55
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

36) chain G
residue 54
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

37) chain G
residue 134
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

38) chain G
residue 105
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA2

39) chain G
residue 55
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1at1
source CSA : CSA2


Display surface

Download
Links