eF-site ID 2air-A
PDB Code 2air
Chain A

click to enlarge
Title T-state Active Site of Aspartate Transcarbamylase:Crystal Structure of the Carbamyl Phosphate and L-alanosine Ligated Enzyme
Classification TRANSFERASE
Compound Aspartate carbamoyltransferase catalytic chain
Source Escherichia coli (strain K12) (PYRI_ECOLI)
Sequence A:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK
HKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTS
LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG
NVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMV
GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILD
MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY
ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
PHAWYFQQAGNGIFARQALLALVLNRDLVL
Description (1)  Aspartate carbamoyltransferase catalytic chain (E.C.2.1.3.2), Aspartate carbamoyltransferase regulatory chain


Functional site

1) chain A
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

2) chain A
residue 55
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

3) chain A
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

4) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CP A 802
source : AC3

5) chain A
residue 51
type
ligand
sequence A
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

6) chain A
residue 52
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

7) chain A
residue 53
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

8) chain A
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

9) chain A
residue 80
type
ligand
sequence S
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

10) chain A
residue 105
type
ligand
sequence R
description BINDING SITE FOR RESIDUE AL0 A 805
source : AC6

11) chain A
residue 50-55
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence EASTRT
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_A_805

12) chain A
residue 105
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence R
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_A_805

13) chain A
residue 268
type binding
ligand AL0: 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE
sequence P
description 3-[HYDROXY(NITROSO)AMINO]-L-ALANINE binding site
source pdb_hetatom : AL0_2air_A_805

14) chain A
residue 52
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence S
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

15) chain A
residue 54-55
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence RT
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

16) chain A
residue 105
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence R
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

17) chain A
residue 127
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence A
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

18) chain A
residue 134
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence H
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

19) chain A
residue 137
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence Q
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

20) chain A
residue 168
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence T
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

21) chain A
residue 266
type binding
ligand CP: PHOSPHORIC ACID MONO(FORMAMIDE)ESTER
sequence P
description PHOSPHORIC ACID MONO(FORMAMIDE)ESTER binding site
source pdb_hetatom : CP_2air_A_802

22) chain A
residue 54
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

23) chain A
residue 134
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

24) chain A
residue 105
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1at1
source CSA : CSA1

25) chain A
residue 55
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1at1
source CSA : CSA1


Display surface

Download
Links