eF-site ID 2ahq_16-A
PDB Code 2ahq
Model 16
Chain A

click to enlarge
Title Solution Structure of the C-terminal RpoN Domain of Sigma-54 from Aquifex aeolicus
Classification TRANSCRIPTION
Compound RNA polymerase sigma factor RpoN
Source Aquifex aeolicus (O66858_AQUAE)
Sequence A:  TYSLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSD
QEIANILKEKGFKVARRTVAKYREMLG
Description (1)  RNA polymerase sigma factor RpoN


Functional site

1) chain A
residue 56-63
type prosite
ligand
sequence RRTVAKYR
description Sigma-54 factors family signature 2. R-R-T-[IV]-[ATN]-K-Y-R
source prosite : PS00718


Display surface

Download
Links