eF-site ID 2abl-A
PDB Code 2abl
Chain A

click to enlarge
Title SH3-SH2 DOMAIN FRAGMENT OF HUMAN BCR-ABL TYROSINE KINASE
Classification TRANSFERASE
Compound ABL TYROSINE KINASE
Source Homo sapiens (Human) (ABL1_HUMAN)
Sequence A:  MGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNH
NGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRN
AAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYR
INTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHY
PAP
Description (1)  ABL TYROSINE KINASE

Display surface

Download
Links