eF-site ID 2abl-A PDB Code 2abl Chain A click to enlarge Title SH3-SH2 DOMAIN FRAGMENT OF HUMAN BCR-ABL TYROSINE KINASE Classification TRANSFERASE Compound ABL TYROSINE KINASE Source Homo sapiens (Human) (ABL1_HUMAN) Sequence A:  MGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNH NGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRN AAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYR INTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHY PAP Description Functional site 1) chain A residue 89 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16912036, ECO:0000269|PubMed:18775435 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 134 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 147 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 158 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 191 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 204 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 234 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links