eF-site ID 2a68-O PDB Code 2a68 Chain O click to enlarge Title Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin Classification TRANSFERASE Compound DNA-directed RNA polymerase alpha chain Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence O:  AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLE PEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVP EDRLQKEMERIYPGE Description Functional site 1) chain O residue 50 type sequence T description BINDING SITE FOR RESIDUE MG O 9209 source : VD1 2) chain O residue 94 type sequence P description BINDING SITE FOR RESIDUE MG O 9231 source : VD2 3) chain O residue 4 type sequence P description BINDING SITE FOR RESIDUE MG O 9337 source : VD3 4) chain O residue 42 type sequence P description BINDING SITE FOR RESIDUE MG O 9355 source : VD4 5) chain O residue 91 type sequence R description BINDING SITE FOR RESIDUE MG O 9359 source : VD5 6) chain O residue 41 type sequence E description BINDING SITE FOR RESIDUE MG O 9362 source : VD6 7) chain O residue 42 type sequence P description BINDING SITE FOR RESIDUE MG O 9362 source : VD6

Display surface Download Links