eF-site ID 2a4l-A PDB Code 2a4l Chain A click to enlarge Title Human cyclin-dependent kinase 2 in complex with roscovitine Classification TRANSFERASE Compound Homo sapiens cyclin-dependent kinase 2 Source (AAP36159) Sequence A:  MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIAIREI SLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMD ASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQN LLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE ILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQL FRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP VPHLRL Description (1)  HUMAN CYCLIN-DEPENDENT KINASE 2 Functional site 1) chain A residue 10 type ligand sequence I description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 2) chain A residue 18 type ligand sequence V description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 3) chain A residue 31 type ligand sequence A description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 4) chain A residue 33 type ligand sequence K description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 5) chain A residue 81 type ligand sequence E description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 6) chain A residue 82 type ligand sequence F description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 7) chain A residue 83 type ligand sequence L description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 8) chain A residue 84 type ligand sequence H description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 9) chain A residue 89 type ligand sequence K description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 10) chain A residue 132 type ligand sequence N description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 11) chain A residue 134 type ligand sequence L description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 12) chain A residue 144 type ligand sequence A description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 13) chain A residue 145 type ligand sequence D description BINDING SITE FOR RESIDUE RRC A 300 source : AC1 14) chain A residue 149 type catalytic ligand sequence A description Mapped from 2phk to 2a4l using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 15) chain A residue 151 type catalytic ligand sequence A description Mapped from 2phk to 2a4l using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 16) chain A residue 10-33 type prosite ligand sequence IGEGTYGVVYKARNKLTGEVVALK description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K. source prosite : PS00107 17) chain A residue 123-135 type prosite ligand sequence VLHRDLKPQNLLI description Serine/Threonine protein kinases active-site signature.[LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3). source prosite : PS00108 18) chain A residue 131 type catalytic ligand sequence Q description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 19) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 20) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 21) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 22) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 23) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 24) chain A residue 165 type catalytic ligand sequence T description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 25) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 26) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 27) chain A residue 132 type catalytic ligand sequence N description Annotated By Reference To The Literature 1ir3 source CSA : CSA4

Display surface Download Links