eF-site ID 1zzy-AB PDB Code 1zzy Chain A, B click to enlarge Title Crystal Structure of Thioredoxin Mutant L7V Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source (THIO_ECOLI) Sequence A:  KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPIL DEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFK NGEVAATKVGALSKGQLKEFLDANLA B:  KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPIL DEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFK NGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 2) chain B residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 3) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194 4) chain A residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain A residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain B residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain B residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 9) chain B residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 10) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 11) chain A residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 12) chain B residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 13) chain B residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3

Display surface Download Links