eF-site ID 1zzs-A PDB Code 1zzs Chain A click to enlarge Title Bovine eNOS N368D single mutant with L-N(omega)-Nitroarginine-(4R)-Amino-L-Proline Amide Bound Classification OXIDOREDUCTASE Compound Nitric-oxide synthase, endothelial Source Bos taurus (Bovine) (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPPPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEA EVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQV FDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRA PGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCI QHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPL EHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSG WYMSTEIGTRDLCDPHRYNILEDVAVXMDLDTRTTSSLWK DKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQ KARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRY QPDPW Description Functional site 1) chain A residue 188 type sequence G description BINDING SITE FOR RESIDUE ACT A 860 source : AC1 2) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE ACT A 860 source : AC1 3) chain A residue 420 type sequence V description BINDING SITE FOR RESIDUE ACT A 860 source : AC1 4) chain A residue 428 type sequence S description BINDING SITE FOR RESIDUE ACT A 860 source : AC1 5) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC4 6) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC4 7) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 8) chain A residue 185 type sequence R description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 9) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 10) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 11) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 12) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 13) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 14) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 15) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 16) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM A 700 source : AC5 17) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 760 source : AC6 18) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 760 source : AC6 19) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 760 source : AC6 20) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 760 source : AC6 21) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 22) chain A residue 336 type sequence P description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 23) chain A residue 338 type sequence V description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 24) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 25) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 26) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 27) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 28) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE DP9 A 799 source : AC7 29) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 761 source : AC9 30) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 761 source : AC9 31) chain A residue 463 type sequence H description BINDING SITE FOR RESIDUE H4B B 761 source : AC9 32) chain A residue 465 type sequence E description BINDING SITE FOR RESIDUE H4B B 761 source : AC9 33) chain A residue 106 type sequence V description BINDING SITE FOR RESIDUE GOL A 880 source : BC2 34) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL A 880 source : BC2 35) chain A residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL A 880 source : BC2 36) chain A residue 105 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 250 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 360 type BINDING sequence M description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 364 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 369 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 450 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 463 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 187 type BINDING sequence V description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 47) chain A residue 97 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 102 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001

Display surface Download Links