eF-site ID 1zvx-A PDB Code 1zvx Chain A click to enlarge Title Crystal structure of the complex between MMP-8 and a phosphonate inhibitor (R-enantiomer) Classification HYDROLASE Compound Neutrophil collagenase Source null (MMP8_HUMAN) Sequence A:  MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFEL WSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGI LAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEF GHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQA IYG Description Functional site 1) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE CA A 996 source : AC1 2) chain A residue 169 type sequence G description BINDING SITE FOR RESIDUE CA A 996 source : AC1 3) chain A residue 171 type sequence G description BINDING SITE FOR RESIDUE CA A 996 source : AC1 4) chain A residue 173 type sequence D description BINDING SITE FOR RESIDUE CA A 996 source : AC1 5) chain A residue 154 type sequence D description BINDING SITE FOR RESIDUE CA A 997 source : AC2 6) chain A residue 155 type sequence G description BINDING SITE FOR RESIDUE CA A 997 source : AC2 7) chain A residue 157 type sequence N description BINDING SITE FOR RESIDUE CA A 997 source : AC2 8) chain A residue 159 type sequence I description BINDING SITE FOR RESIDUE CA A 997 source : AC2 9) chain A residue 177 type sequence D description BINDING SITE FOR RESIDUE CA A 997 source : AC2 10) chain A residue 180 type sequence E description BINDING SITE FOR RESIDUE CA A 997 source : AC2 11) chain A residue 147 type sequence H description BINDING SITE FOR RESIDUE ZN A 998 source : AC3 12) chain A residue 149 type sequence D description BINDING SITE FOR RESIDUE ZN A 998 source : AC3 13) chain A residue 162 type sequence H description BINDING SITE FOR RESIDUE ZN A 998 source : AC3 14) chain A residue 175 type sequence H description BINDING SITE FOR RESIDUE ZN A 998 source : AC3 15) chain A residue 197 type sequence H description BINDING SITE FOR RESIDUE ZN A 999 source : AC4 16) chain A residue 201 type sequence H description BINDING SITE FOR RESIDUE ZN A 999 source : AC4 17) chain A residue 207 type sequence H description BINDING SITE FOR RESIDUE ZN A 999 source : AC4 18) chain A residue 159 type sequence I description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 19) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 20) chain A residue 161 type sequence A description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 21) chain A residue 162 type sequence H description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 22) chain A residue 193 type sequence L description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 23) chain A residue 197 type sequence H description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 24) chain A residue 198 type sequence E description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 25) chain A residue 201 type sequence H description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 26) chain A residue 207 type sequence H description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 27) chain A residue 214 type sequence L description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 28) chain A residue 216 type sequence Y description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 29) chain A residue 217 type sequence P description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 30) chain A residue 218 type sequence N description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 31) chain A residue 219 type sequence Y description BINDING SITE FOR RESIDUE FIN A 994 source : AC5 32) chain A residue 155 type BINDING sequence G description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 33) chain A residue 180 type BINDING sequence E description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 197 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 201 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 207 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 37) chain A residue 157 type BINDING sequence N description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 38) chain A residue 159 type BINDING sequence I description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 39) chain A residue 162 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 40) chain A residue 175 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 41) chain A residue 177 type BINDING sequence D description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 42) chain A residue 147 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 149 type BINDING sequence D description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 44) chain A residue 154 type BINDING sequence D description BINDING => ECO:0000269|PubMed:8137810 source Swiss-Prot : SWS_FT_FI3 45) chain A residue 92 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine source Swiss-Prot : SWS_FT_FI4 46) chain A residue 184 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 47) chain A residue 226 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 48) chain A residue 194-203 type prosite sequence VAAHEFGHSL description ZINC_PROTEASE Neutral zinc metallopeptidases, zinc-binding region signature. VAAHEFGHSL source prosite : PS00142 49) chain A residue 198 type ACT_SITE sequence E description source Swiss-Prot : SWS_FT_FI1 50) chain A residue 171 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 173 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 52) chain A residue 137 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 53) chain A residue 169 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links