eF-site ID 1zud-1 PDB Code 1zud Chain 1 click to enlarge Title Structure of ThiS-ThiF protein complex Classification TRANSFERASE/BIOSYNTHETIC PROTEIN Compound Adenylyltransferase thiF Source Escherichia coli (strain K12) (THIS_ECOLI) Sequence 1:  MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLG TPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDID RPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARAD VVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMV LTPPWEQGCYRCLWPAGVVGPVVGVMGTLQALEAIKLLSG IETPAGELRLFDGKSSQWRSLALRRASGCPVCGG Description Functional site 1) chain 1 residue 169 type sequence C description BINDING SITE FOR RESIDUE ZN 1 501 source : AC1 2) chain 1 residue 172 type sequence C description BINDING SITE FOR RESIDUE ZN 1 501 source : AC1 3) chain 1 residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN 1 501 source : AC1 4) chain 1 residue 243 type sequence C description BINDING SITE FOR RESIDUE ZN 1 501 source : AC1 5) chain 1 residue 14 type sequence L description BINDING SITE FOR RESIDUE CA 3 601 source : AC3 6) chain 1 residue 16 type sequence D description BINDING SITE FOR RESIDUE CA 3 601 source : AC3 7) chain 1 residue 243 type sequence C description BINDING SITE FOR RESIDUE CA 1 602 source : AC4 8) chain 1 residue 116 type sequence V description BINDING SITE FOR RESIDUE NA 1 701 source : AC5 9) chain 1 residue 117 type sequence A description BINDING SITE FOR RESIDUE NA 1 701 source : AC5 10) chain 1 residue 119 type sequence A description BINDING SITE FOR RESIDUE NA 1 701 source : AC5 11) chain 1 residue 144 type sequence T description BINDING SITE FOR RESIDUE NA 1 701 source : AC5 12) chain 1 residue 38 type CROSSLNK sequence G description Glycyl cysteine dithioester (Gly-Cys) (interchain with C-184 in ThiF); alternate source Swiss-Prot : SWS_FT_FI2 13) chain 1 residue 70 type CROSSLNK sequence R description Glycyl cysteine dithioester (Gly-Cys) (interchain with C-184 in ThiF); alternate source Swiss-Prot : SWS_FT_FI2 14) chain 1 residue 83 type CROSSLNK sequence K description Glycyl cysteine dithioester (Gly-Cys) (interchain with C-184 in ThiF); alternate source Swiss-Prot : SWS_FT_FI2 15) chain 1 residue 107 type CROSSLNK sequence L description Glycyl cysteine dithioester (Gly-Cys) (interchain with C-184 in ThiF); alternate source Swiss-Prot : SWS_FT_FI2 16) chain 1 residue 127 type CROSSLNK sequence D description Glycyl cysteine dithioester (Gly-Cys) (interchain with C-184 in ThiF); alternate source Swiss-Prot : SWS_FT_FI2 17) chain 1 residue 169 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 18) chain 1 residue 172 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 19) chain 1 residue 240 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 20) chain 1 residue 243 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links