eF-site ID 1zsf-A PDB Code 1zsf Chain A click to enlarge Title Crystal Structure of Complex of a Hydroxyethylamine Inhibitor with HIV-1 Protease at 2.0A Resolution Classification HYDROLASE/HYDROLASE INHIBITOR Compound PROTEASE RETROPEPSIN Source Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1) (POL_HV1BR) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQILIEIXGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 2) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 3) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 4) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 5) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 6) chain A residue 32 type sequence V description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 7) chain A residue 47 type sequence I description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 8) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 9) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 10) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 11) chain A residue 53 type sequence F description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 12) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 13) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 14) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 15) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 16) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000269|PubMed:12924029 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000269|PubMed:2476069 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links