eF-site ID 1zrr_1-A PDB Code 1zrr Model 1 Chain A click to enlarge Title Residual Dipolar Coupling Refinement of Acireductone Dioxygenase from Klebsiella Classification OXIDOREDUCTASE Compound E-2/E-2' protein Source Klebsiella oxytoca (Q9ZFE7_KLEOX) Sequence A:  SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQA DRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISLRA DNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDE VFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPE GWIAQFTGDDIASAYPRLA Description Functional site 1) chain A residue 96 type sequence H description BINDING SITE FOR RESIDUE NI A 180 source : AC1 2) chain A residue 98 type sequence H description BINDING SITE FOR RESIDUE NI A 180 source : AC1 3) chain A residue 102 type sequence E description BINDING SITE FOR RESIDUE NI A 180 source : AC1 4) chain A residue 140 type sequence H description BINDING SITE FOR RESIDUE NI A 180 source : AC1 5) chain A residue 97 type BINDING sequence T description BINDING => ECO:0000269|PubMed:16518698, ECO:0007744|PDB:1ZRR source Swiss-Prot : SWS_FT_FI1 6) chain A residue 99 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16518698, ECO:0007744|PDB:1ZRR source Swiss-Prot : SWS_FT_FI1 7) chain A residue 103 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16518698, ECO:0007744|PDB:1ZRR source Swiss-Prot : SWS_FT_FI1 8) chain A residue 141 type BINDING sequence W description BINDING => ECO:0000269|PubMed:16518698, ECO:0007744|PDB:1ZRR source Swiss-Prot : SWS_FT_FI1 9) chain A residue 96 type SITE sequence H description May play a role in metal incorporation in vivo source Swiss-Prot : SWS_FT_FI2 10) chain A residue 102 type SITE sequence E description May play a role in transmitting local conformational changes source Swiss-Prot : SWS_FT_FI3 11) chain A residue 105 type SITE sequence F description Important to generate the dianion source Swiss-Prot : SWS_FT_FI4

Display surface Download Links