eF-site ID 1zla-ABCDEFGHK
PDB Code 1zla
Chain A, B, C, D, E, F, G, H, K

click to enlarge
Title X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
Classification STRUCTURAL PROTEIN/DNA
Compound Palindromic 146bp Human alpha-Satellite DNA fragment
Source (1ZLA)
Sequence A:  PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRV
HIMPKDIQLARRIRGERA
B:  DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLE
NVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
C:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA
VLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPKKT
D:  RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFER
IAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSAK
E:  PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRV
HIMPKDIQLARRIRGERA
F:  RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVL
KVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
G:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA
VLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPKK
H:  RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFER
IAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSAK
K:  PGMRLRSGRSTGAP
Description (1)  Histone H3, H4, H2A, H2B/LANA Peptide/DNA


Functional site

1) chain A
residue 466-474
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959

2) chain E
residue 666-674
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959

3) chain C
residue 821-827
type prosite
ligand
sequence AGLQFPV
description Histone H2A signature.[AC]-G-L-x-F-P-V.
source prosite : PS00046

4) chain G
residue 1021-1027
type prosite
ligand
sequence AGLQFPV
description Histone H2A signature.[AC]-G-L-x-F-P-V.
source prosite : PS00046

5) chain D
residue 1289-1311
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature.[KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A-[LIVM]-[STA]-E-G.
source prosite : PS00357

6) chain H
residue 1489-1511
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature.[KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A-[LIVM]-[STA]-E-G.
source prosite : PS00357


Display surface

Download
Links