eF-site ID 1zla-A
PDB Code 1zla
Chain A

click to enlarge
Title X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
Classification PROTEIN BINDING/VIRUS/DNA
Compound Palindromic 146bp Human alpha-Satellite DNA fragment
Source Xenopus laevis (African clawed frog) (1ZLA)
Sequence A:  PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRV
HIMPKDIQLARRIRGERA
Description (1)  Histone H3, H4, H2A, H2B/LANA Peptide/DNA

Display surface

Download
Links