eF-site ID 1zfn-A PDB Code 1zfn Chain A click to enlarge Title Structural Analysis of Escherichia coli ThiF Classification TRANSFERASE Compound Adenylyltransferase thiF Source Escherichia coli (strain K12) (THIF_ECOLI) Sequence A:  MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLG TPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDID RPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARAD VVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMV LTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTL QALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGC PVCG Description Functional site 1) chain A residue 169 type sequence C description BINDING SITE FOR RESIDUE ZN A 252 source : AC1 2) chain A residue 172 type sequence C description BINDING SITE FOR RESIDUE ZN A 252 source : AC1 3) chain A residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN A 252 source : AC1 4) chain A residue 243 type sequence C description BINDING SITE FOR RESIDUE ZN A 252 source : AC1 5) chain A residue 34 type sequence I description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 6) chain A residue 35 type sequence G description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 7) chain A residue 37 type sequence G description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 8) chain A residue 38 type sequence G description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 9) chain A residue 59 type sequence D description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 10) chain A residue 61 type sequence D description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 11) chain A residue 70 type sequence R description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 12) chain A residue 71 type sequence Q description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 13) chain A residue 83 type sequence K description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 14) chain A residue 105 type sequence Q description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 15) chain A residue 106 type sequence R description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 16) chain A residue 107 type sequence L description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 17) chain A residue 125 type sequence C description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 18) chain A residue 126 type sequence T description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 19) chain A residue 127 type sequence D description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 20) chain A residue 131 type sequence T description BINDING SITE FOR RESIDUE ATP A 253 source : AC7 21) chain A residue 11 type sequence R description BINDING SITE FOR RESIDUE ATP B 253 source : AC8 22) chain A residue 184 type ACT_SITE sequence C description Glycyl persulfide ester intermediate source Swiss-Prot : SWS_FT_FI1 23) chain A residue 11 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 38 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 59 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 70 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 83 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 107 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 29) chain A residue 127 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 30) chain A residue 169 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 31) chain A residue 172 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 32) chain A residue 240 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 33) chain A residue 243 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16388576 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 184 type CROSSLNK sequence C description Glycyl cysteine dithioester (Cys-Gly) (interchain with G-Cter in ThiS) source Swiss-Prot : SWS_FT_FI4

Display surface Download Links