eF-site ID 1zcp-ABCD PDB Code 1zcp Chain A, B, C, D click to enlarge Title Crystal Structure of a catalytic site mutant E. coli TrxA (CACA) Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence A:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANL B:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANL C:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANL D:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANL Description Functional site 1) chain A residue 33 type ACT_SITE sequence A description Nucleophile source Swiss-Prot : SWS_FT_FI1 2) chain A residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 3) chain B residue 33 type ACT_SITE sequence A description Nucleophile source Swiss-Prot : SWS_FT_FI1 4) chain B residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain C residue 33 type ACT_SITE sequence A description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain C residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain D residue 33 type ACT_SITE sequence A description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain D residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 9) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 10) chain B residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 11) chain C residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 12) chain D residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 13) chain A residue 34 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 14) chain A residue 35 type SITE sequence A description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 15) chain B residue 34 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 16) chain B residue 35 type SITE sequence A description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 17) chain C residue 34 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 18) chain C residue 35 type SITE sequence A description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 19) chain D residue 34 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 20) chain D residue 35 type SITE sequence A description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 21) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 22) chain B residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 23) chain C residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 24) chain D residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links