eF-site ID 1zbg-A PDB Code 1zbg Chain A click to enlarge Title Crystal structure of a complex of mutant hiv-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2 Classification HYDROLASE/HYDROLASE INHIBITOR Compound PROTEASE RETROPEPSIN Source Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1) (POL_HV1BR) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQILIEIXGHKVIGTVLVGPT PTNVIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 2) chain A residue 23 type sequence L description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 3) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 4) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 5) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 6) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 7) chain A residue 82 type sequence T description BINDING SITE FOR RESIDUE 0ZS B 201 source : AC1 8) chain A residue 73 type sequence G description BINDING SITE FOR RESIDUE CL A 211 source : AC2 9) chain A residue 74 type sequence T description BINDING SITE FOR RESIDUE CL A 211 source : AC2 10) chain A residue 88 type sequence N description BINDING SITE FOR RESIDUE CL A 211 source : AC2 11) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE CL B 212 source : AC3 12) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE CL A 213 source : AC4 13) chain A residue 78 type sequence G description BINDING SITE FOR RESIDUE NA B 214 source : AC5 14) chain A residue 80 type sequence T description BINDING SITE FOR RESIDUE NA B 214 source : AC5 15) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 16) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links