eF-site ID 1z7q-W PDB Code 1z7q Chain W click to enlarge Title Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator PA26 from Trypanosome brucei at 3.2 angstroms resolution Classification HYDROLASE/HYDROLASE ACTIVATOR Compound Proteasome component C7-alpha Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (Q9U8G2_9TRYP) Sequence W:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICD Description Functional site 1) chain W residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 2) chain W residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 3) chain W residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 4) chain W residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 5) chain W residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 6) chain W residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 7) chain W residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 8) chain W residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links