eF-site ID 1z3u-A PDB Code 1z3u Chain A click to enlarge Title Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces Involved in Tie2 Recognition Classification SIGNALING PROTEIN Compound Angiopoietin-2 Source Homo sapiens (Human) (AGP2_HUMAN) Sequence A:  SFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGG GGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEF VSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNY RIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQ MLTGGWWFDACGPSNLNGMYYPQRQNTNKANGIKWAAWKG SGYSLKATTMMIRPAD Description Functional site 1) chain A residue 429 type sequence D description BINDING SITE FOR RESIDUE CA A 497 source : AC1 2) chain A residue 431 type sequence D description BINDING SITE FOR RESIDUE CA A 497 source : AC1 3) chain A residue 433 type sequence C description BINDING SITE FOR RESIDUE CA A 497 source : AC1 4) chain A residue 435 type sequence C description BINDING SITE FOR RESIDUE CA A 497 source : AC1 5) chain A residue 445-457 type prosite sequence WWFDACGPSNLNG description FIBRINOGEN_C_1 Fibrinogen C-terminal domain signature. WWFdaCgpSnlNG source prosite : PS00514 6) chain A residue 429 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15893672, ECO:0000269|PubMed:16732286, ECO:0007744|PDB:1Z3U source Swiss-Prot : SWS_FT_FI1 7) chain A residue 431 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15893672, ECO:0000269|PubMed:16732286, ECO:0007744|PDB:1Z3U source Swiss-Prot : SWS_FT_FI1 8) chain A residue 433 type BINDING sequence C description BINDING => ECO:0000269|PubMed:15893672, ECO:0000269|PubMed:16732286, ECO:0007744|PDB:1Z3U source Swiss-Prot : SWS_FT_FI1 9) chain A residue 435 type BINDING sequence C description BINDING => ECO:0000269|PubMed:15893672, ECO:0000269|PubMed:16732286, ECO:0007744|PDB:1Z3U source Swiss-Prot : SWS_FT_FI1 10) chain A residue 304 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links