eF-site ID 1yxu-A PDB Code 1yxu Chain A click to enlarge Title Crystal Structure of Kinase Pim1 in Complex with AMP Classification TRANSFERASE Compound Proto-oncogene serine/threonine-protein kinase Pim-1 Source Homo sapiens (Human) (PIM1_HUMAN) Sequence A:  PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKD RISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFER PDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVL EAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGAL LKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILL YDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLA LRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLH Description Functional site 1) chain A residue 130 type sequence F description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 2) chain A residue 134 type sequence T description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 3) chain A residue 170 type sequence D description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 4) chain A residue 234 type sequence D description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 5) chain A residue 238 type sequence G description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 6) chain A residue 239 type sequence D description BINDING SITE FOR RESIDUE IMD A 500 source : AC1 7) chain A residue 44 type sequence L description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 8) chain A residue 49 type sequence F description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 9) chain A residue 65 type sequence A description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 10) chain A residue 67 type sequence K description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 11) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 12) chain A residue 104 type sequence I description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 13) chain A residue 120 type sequence L description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 14) chain A residue 171 type sequence E description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 15) chain A residue 172 type sequence N description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 16) chain A residue 174 type sequence L description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 17) chain A residue 185 type sequence I description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 18) chain A residue 186 type sequence D description BINDING SITE FOR RESIDUE AMP A 550 source : AC5 19) chain A residue 44-67 type prosite sequence LGSGGFGSVYSGIRVSDNLPVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGSGGFGSVYsGirvsdnlp..........VAIK source prosite : PS00107 20) chain A residue 163-175 type prosite sequence VLHRDIKDENILI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDIKdeNILI source prosite : PS00108 21) chain A residue 167 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 44 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 67 type BINDING sequence K description BINDING => ECO:0000305|PubMed:15525646, ECO:0000305|PubMed:15657054, ECO:0000305|PubMed:15808862 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 121 type BINDING sequence E description BINDING => ECO:0000305|PubMed:15525646, ECO:0000305|PubMed:15657054, ECO:0000305|PubMed:15808862 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 128 type BINDING sequence D description BINDING => ECO:0000305|PubMed:15525646, ECO:0000305|PubMed:15657054, ECO:0000305|PubMed:15808862 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 98 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:15657054 source Swiss-Prot : SWS_FT_FI4 27) chain A residue 261 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:15657054 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links