eF-site ID 1yxt-A PDB Code 1yxt Chain A click to enlarge Title Crystal Structure of Kinase Pim1 in complex with AMPPNP Classification TRANSFERASE Compound Proto-oncogene serine/threonine-protein kinase Pim-1 Source Homo sapiens (Human) (PIM1_HUMAN) Sequence A:  PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKD RISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFER PDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVL EAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGAL LKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILL YDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLA LRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHS Description Functional site 1) chain A residue 44 type sequence L description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 2) chain A residue 46 type sequence S description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 3) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 4) chain A residue 49 type sequence F description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 5) chain A residue 50 type sequence G description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 6) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 7) chain A residue 65 type sequence A description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 8) chain A residue 67 type sequence K description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 9) chain A residue 104 type sequence I description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 10) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 11) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 12) chain A residue 167 type sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 13) chain A residue 171 type sequence E description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 14) chain A residue 172 type sequence N description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 15) chain A residue 174 type sequence L description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 16) chain A residue 185 type sequence I description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 17) chain A residue 186 type sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 18) chain A residue 167 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 19) chain A residue 171 type catalytic sequence E description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 20) chain A residue 169 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 21) chain A residue 167 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 22) chain A residue 204 type catalytic sequence T description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 23) chain A residue 169 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 24) chain A residue 167 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 25) chain A residue 172 type catalytic sequence N description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 26) chain A residue 169 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 27) chain A residue 167 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 28) chain A residue 44-67 type prosite sequence LGSGGFGSVYSGIRVSDNLPVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGSGGFGSVYsGirvsdnlp..........VAIK source prosite : PS00107 29) chain A residue 163-175 type prosite sequence VLHRDIKDENILI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDIKdeNILI source prosite : PS00108 30) chain A residue 149 type catalytic sequence W description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 31) chain A residue 151 type catalytic sequence V description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1

Display surface Download Links