eF-site ID 1yxt-A
PDB Code 1yxt
Chain A

click to enlarge
Title Crystal Structure of Kinase Pim1 in complex with AMPPNP
Classification TRANSFERASE
Compound Proto-oncogene serine/threonine-protein kinase Pim-1
Source Homo sapiens (Human) (PIM1_HUMAN)
Sequence A:  PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKD
RISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFER
PDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVL
EAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGAL
LKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILL
YDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLA
LRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHS
Description (1)  Proto-oncogene serine/threonine-protein kinase Pim-1 (E.C.2.7.1.37)


Functional site

1) chain A
residue 44
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

2) chain A
residue 46
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

3) chain A
residue 48
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

4) chain A
residue 49
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

5) chain A
residue 50
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

6) chain A
residue 52
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

7) chain A
residue 65
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

8) chain A
residue 67
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

9) chain A
residue 104
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

10) chain A
residue 121
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

11) chain A
residue 128
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

12) chain A
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

13) chain A
residue 171
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

14) chain A
residue 172
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

15) chain A
residue 174
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

16) chain A
residue 185
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

17) chain A
residue 186
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ANP A 322
source : AC1

18) chain A
residue 139
type ACT_SITE
ligand
sequence L
description Proton acceptor. {ECO:0000255|PROSITE- ProRule:PRU00159, ECO:0000255|PROSITE- ProRule:PRU10027}.
source Swiss-Prot : SWS_FT_FI1

19) chain A
residue 39
type BINDING
ligand
sequence Q
description ATP.
source Swiss-Prot : SWS_FT_FI2

20) chain A
residue 100
type BINDING
ligand
sequence F
description ATP.
source Swiss-Prot : SWS_FT_FI2

21) chain A
residue 93
type BINDING
ligand
sequence L
description ATP; via carbonyl oxygen.
source Swiss-Prot : SWS_FT_FI3

22) chain A
residue 149
type catalytic
ligand
sequence W
description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

23) chain A
residue 151
type catalytic
ligand
sequence V
description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

24) chain A
residue 44-67
type prosite
ligand
sequence LGSGGFGSVYSGIRVSDNLPVAIK
description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K.
source prosite : PS00107

25) chain A
residue 163-175
type prosite
ligand
sequence VLHRDIKDENILI
description Serine/Threonine protein kinases active-site signature.[LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3).
source prosite : PS00108

26) chain A
residue 167
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

27) chain A
residue 171
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

28) chain A
residue 169
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

29) chain A
residue 167
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

30) chain A
residue 204
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

31) chain A
residue 169
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

32) chain A
residue 167
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

33) chain A
residue 172
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

34) chain A
residue 169
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

35) chain A
residue 167
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4


Display surface

Download
Links