eF-site ID 1yxt-A PDB Code 1yxt Chain A click to enlarge Title Crystal Structure of Kinase Pim1 in complex with AMPPNP Classification TRANSFERASE Compound Proto-oncogene serine/threonine-protein kinase Pim-1 Source Homo sapiens (Human) (PIM1_HUMAN) Sequence A:  PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKD RISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFER PDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVL EAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGAL LKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILL YDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLA LRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHS Description (1)  Proto-oncogene serine/threonine-protein kinase Pim-1 (E.C.2.7.1.37) Functional site 1) chain A residue 44 type ligand sequence L description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 2) chain A residue 46 type ligand sequence S description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 3) chain A residue 48 type ligand sequence G description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 4) chain A residue 49 type ligand sequence F description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 5) chain A residue 50 type ligand sequence G description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 6) chain A residue 52 type ligand sequence V description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 7) chain A residue 65 type ligand sequence A description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 8) chain A residue 67 type ligand sequence K description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 9) chain A residue 104 type ligand sequence I description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 10) chain A residue 121 type ligand sequence E description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 11) chain A residue 128 type ligand sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 12) chain A residue 167 type ligand sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 13) chain A residue 171 type ligand sequence E description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 14) chain A residue 172 type ligand sequence N description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 15) chain A residue 174 type ligand sequence L description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 16) chain A residue 185 type ligand sequence I description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 17) chain A residue 186 type ligand sequence D description BINDING SITE FOR RESIDUE ANP A 322 source : AC1 18) chain A residue 139 type ACT_SITE ligand sequence L description Proton acceptor. {ECO:0000255|PROSITE- ProRule:PRU00159, ECO:0000255|PROSITE- ProRule:PRU10027}. source Swiss-Prot : SWS_FT_FI1 19) chain A residue 39 type BINDING ligand sequence Q description ATP. source Swiss-Prot : SWS_FT_FI2 20) chain A residue 100 type BINDING ligand sequence F description ATP. source Swiss-Prot : SWS_FT_FI2 21) chain A residue 93 type BINDING ligand sequence L description ATP; via carbonyl oxygen. source Swiss-Prot : SWS_FT_FI3 22) chain A residue 149 type catalytic ligand sequence W description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 23) chain A residue 151 type catalytic ligand sequence V description Mapped from 2phk to 1yxt using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 24) chain A residue 44-67 type prosite ligand sequence LGSGGFGSVYSGIRVSDNLPVAIK description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K. source prosite : PS00107 25) chain A residue 163-175 type prosite ligand sequence VLHRDIKDENILI description Serine/Threonine protein kinases active-site signature.[LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3). source prosite : PS00108 26) chain A residue 167 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 27) chain A residue 171 type catalytic ligand sequence E description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 28) chain A residue 169 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 29) chain A residue 167 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA2 30) chain A residue 204 type catalytic ligand sequence T description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 31) chain A residue 169 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 32) chain A residue 167 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 33) chain A residue 172 type catalytic ligand sequence N description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 34) chain A residue 169 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA4 35) chain A residue 167 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA4

Display surface Download Links