eF-site ID 1ysx-A PDB Code 1ysx Chain A click to enlarge Title Solution structure of domain 3 from human serum albumin complexed to an anti-apoptotic ligand directed against Bcl-xL and Bcl-2 Classification APOPTOSIS Compound Serum albumin Source Homo sapiens (Human) (ALBU_HUMAN) Sequence A:  QNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLV EVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLH EKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNA ETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQL KAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALG Description Functional site 1) chain A residue 391 type sequence N description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 2) chain A residue 392 type sequence C description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 3) chain A residue 407 type sequence L description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 4) chain A residue 411 type sequence Y description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 5) chain A residue 414 type sequence K description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 6) chain A residue 415 type sequence V description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 7) chain A residue 422 type sequence T description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 8) chain A residue 423 type sequence L description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 9) chain A residue 426 type sequence V description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 10) chain A residue 452 type sequence Y description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 11) chain A residue 460 type sequence L description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 12) chain A residue 464 type sequence H description BINDING SITE FOR RESIDUE 4EB A 1000 source : AC1 13) chain A residue 551-575 type prosite sequence FAAFVEKCCKADDKETCFAEEGKKL description ALBUMIN_1 Albumin domain signature. FaafvekCCkaDdketCFaeegkkL source prosite : PS00212 14) chain A residue 389 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 524 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 538 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 541 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 557 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 560 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 564 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 574 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 402 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 414 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 432 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 436 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 466 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 475 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 500 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 519 type SITE sequence K description Not glycated => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 525 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine => ECO:0000269|PubMed:15047055, ECO:0000269|PubMed:3759977, ECO:0000269|PubMed:6706980, ECO:0000269|PubMed:6853480 source Swiss-Prot : SWS_FT_FI10 31) chain A residue 534 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; alternate => ECO:0000269|PubMed:3759977 source Swiss-Prot : SWS_FT_FI11 32) chain A residue 419 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 420 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 422 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 436 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P07724 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 519 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P07724 source Swiss-Prot : SWS_FT_FI4 37) chain A residue 564 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P07724 source Swiss-Prot : SWS_FT_FI4 38) chain A residue 489 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5 39) chain A residue 534 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI6 40) chain A residue 413 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI7 41) chain A residue 444 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI7 42) chain A residue 536 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI7 43) chain A residue 545 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI7 44) chain A residue 573 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:15047055 source Swiss-Prot : SWS_FT_FI7 45) chain A residue 439 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine => ECO:0000269|PubMed:3759977 source Swiss-Prot : SWS_FT_FI8 46) chain A residue 494 type CARBOHYD sequence D description N-linked (GlcNAc...) asparagine; in variant Casebrook source Swiss-Prot : SWS_FT_FI9

Display surface Download Links