eF-site ID 1ysb-B
PDB Code 1ysb
Chain B

click to enlarge
Title Yeast Cytosine Deaminase Triple Mutant
Classification HYDROLASE
Compound Cytosine deaminase
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (FCY1_YEAST)
Sequence B:  GSSMVTGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCL
INNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGK
VYKDTTLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSK
GEKYLQTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIG
E
Description (1)  Cytosine deaminase (E.C.3.5.4.1)


Functional site

1) chain B
residue 262
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

2) chain B
residue 291
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

3) chain B
residue 294
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

4) chain B
residue 264
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 502
source : AC3

5) chain B
residue 326
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA B 504
source : AC5

6) chain B
residue 346
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 504
source : AC5

7) chain B
residue 262-298
type prosite
ligand
sequence HGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI
description Cytidine and deoxycytidylate deaminases zinc-binding region signature. [CH]-[AGV]-E-x(2)-[LIVMFGAT]-[LIVM]-x(17,33)-P-C-x(2,8)-C-x(3)-[LIVM]
source prosite : PS00903

8) chain B
residue 264
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2

9) chain B
residue 291
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2

10) chain B
residue 289
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2


Display surface

Download
Links