eF-site ID 1ysb-AB
PDB Code 1ysb
Chain A, B

click to enlarge
Title Yeast Cytosine Deaminase Triple Mutant
Classification HYDROLASE
Compound Cytosine deaminase
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (FCY1_YEAST)
Sequence A:  TGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKD
GSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDT
TLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSKGEKYL
QTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE
B:  GSSMVTGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCL
INNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGK
VYKDTTLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSK
GEKYLQTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIG
E
Description (1)  Cytosine deaminase (E.C.3.5.4.1)


Functional site

1) chain B
residue 262
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

2) chain B
residue 291
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

3) chain B
residue 294
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 500
source : AC1

4) chain A
residue 62
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

5) chain A
residue 91
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

6) chain A
residue 94
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

7) chain B
residue 264
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 502
source : AC3

8) chain A
residue 64
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 503
source : AC4

9) chain B
residue 326
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA B 504
source : AC5

10) chain B
residue 346
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 504
source : AC5

11) chain A
residue 67
type ACT_SITE
ligand
sequence T
description Proton donor.
source Swiss-Prot : SWS_FT_FI1

12) chain A
residue 65
type METAL
ligand
sequence I
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

13) chain A
residue 94
type METAL
ligand
sequence C
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

14) chain A
residue 97
type METAL
ligand
sequence A
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

15) chain A
residue 54
type BINDING
ligand
sequence F
description Substrate.
source Swiss-Prot : SWS_FT_FI3

16) chain A
residue 158
type BINDING
ligand
sequence E
description Substrate.
source Swiss-Prot : SWS_FT_FI3

17) chain A
residue 62-98
type prosite
ligand
sequence HGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI
description Cytidine and deoxycytidylate deaminases zinc-binding region signature. [CH]-[AGV]-E-x(2)-[LIVMFGAT]-[LIVM]-x(17,33)-P-C-x(2,8)-C-x(3)-[LIVM]
source prosite : PS00903

18) chain B
residue 262-298
type prosite
ligand
sequence HGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI
description Cytidine and deoxycytidylate deaminases zinc-binding region signature. [CH]-[AGV]-E-x(2)-[LIVMFGAT]-[LIVM]-x(17,33)-P-C-x(2,8)-C-x(3)-[LIVM]
source prosite : PS00903

19) chain A
residue 64
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1

20) chain A
residue 91
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1

21) chain A
residue 89
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1

22) chain B
residue 264
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2

23) chain B
residue 291
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2

24) chain B
residue 289
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1uaq
source CSA : CSA2


Display surface

Download
Links