eF-site ID 1ysb-A
PDB Code 1ysb
Chain A

click to enlarge
Title Yeast Cytosine Deaminase Triple Mutant
Classification HYDROLASE
Compound Cytosine deaminase
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (FCY1_YEAST)
Sequence A:  TGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKD
GSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDT
TLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSKGEKYL
QTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE
Description (1)  Cytosine deaminase (E.C.3.5.4.1)


Functional site

1) chain A
residue 62
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

2) chain A
residue 91
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

3) chain A
residue 94
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 501
source : AC2

4) chain A
residue 64
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 503
source : AC4

5) chain A
residue 67
type ACT_SITE
ligand
sequence T
description Proton donor.
source Swiss-Prot : SWS_FT_FI1

6) chain A
residue 65
type METAL
ligand
sequence I
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

7) chain A
residue 94
type METAL
ligand
sequence C
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

8) chain A
residue 97
type METAL
ligand
sequence A
description Zinc; catalytic
source Swiss-Prot : SWS_FT_FI2

9) chain A
residue 54
type BINDING
ligand
sequence F
description Substrate.
source Swiss-Prot : SWS_FT_FI3

10) chain A
residue 158
type BINDING
ligand
sequence E
description Substrate.
source Swiss-Prot : SWS_FT_FI3

11) chain A
residue 62-98
type prosite
ligand
sequence HGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI
description Cytidine and deoxycytidylate deaminases zinc-binding region signature. [CH]-[AGV]-E-x(2)-[LIVMFGAT]-[LIVM]-x(17,33)-P-C-x(2,8)-C-x(3)-[LIVM]
source prosite : PS00903

12) chain A
residue 64
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1

13) chain A
residue 91
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1

14) chain A
residue 89
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1uaq
source CSA : CSA1


Display surface

Download
Links