eF-site ID 1yrl-D
PDB Code 1yrl
Chain D

click to enlarge
Title Escherichia coli ketol-acid reductoisomerase
Classification OXIDOREDUCTASE
Compound Ketol-acid reductoisomerase
Source Escherichia coli (strain K12) (ILVC_ECOLI)
Sequence D:  NYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVI
VLNQGLNMRDSGLDISYALRKEAIAEGFKVGTYEELIPQA
DLVINLTPDKQHSDVVRTVQPLMKDGAALGYSHGFNIVEV
GEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHP
ENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLM
GEQTILCGMLQAGSLLCFDKLVEEGTDPAYAEKLIQFGWE
TITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPL
FQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAF
ETAPQYEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVDS
GIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEY
GNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLR
DVNEAIRSHAIEQVGKKLRGYMTDMKRIAV
Description (1)  Ketol-acid reductoisomerase(E.C.1.1.1.86)


Functional site

1) chain D
residue 3
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 D 4123
source : AC3

2) chain D
residue 6
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 D 4123
source : AC3

3) chain D
residue 11
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 D 4124
source : AC4

4) chain D
residue 12
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 D 4124
source : AC4

5) chain D
residue 201
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 D 4129
source : AC9

6) chain D
residue 202
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 D 4129
source : AC9

7) chain D
residue 133
type ACT_SITE
ligand
sequence G
description {ECO:0000255|HAMAP-Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI31

8) chain D
residue 218
type METAL
ligand
sequence L
description Magnesium 1. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI32

9) chain D
residue 222
type METAL
ligand
sequence Q
description Magnesium 1. {ECO:0000255|HAMAP- Rule:MF_00435}
source Swiss-Prot : SWS_FT_FI33

10) chain D
residue 218
type METAL
ligand
sequence L
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI34

11) chain D
residue 390
type METAL
ligand
sequence S
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI34

12) chain D
residue 394
type METAL
ligand
sequence L
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI34

13) chain D
residue 159
type BINDING
ligand
sequence T
description NADP; via amide nitrogen. {ECO:0000255|HAMAP-Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI36

14) chain D
residue 69
type BINDING
ligand
sequence K
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000305|PubMed:9015391}.
source Swiss-Prot : SWS_FT_FI37

15) chain D
residue 415
type BINDING
ligand
sequence D
description Substrate. {ECO:0000255|HAMAP- Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI38

16) chain D
residue 109-111
type NP_BIND
ligand
sequence KQH
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000269|PubMed:23036858}.
source Swiss-Prot : SWS_FT_FI40

17) chain D
residue 393
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1yve
source CSA : CSA4

18) chain D
residue 383
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1yve
source CSA : CSA8


Display surface

Download
Links