eF-site ID 1yrl-A
PDB Code 1yrl
Chain A

click to enlarge
Title Escherichia coli ketol-acid reductoisomerase
Classification OXIDOREDUCTASE
Compound Ketol-acid reductoisomerase
Source Escherichia coli (strain K12) (ILVC_ECOLI)
Sequence A:  NYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVI
VGCGAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKA
TENGFKVGTYEELIPQADLVINLTPDKQHSDVVRTVQPLM
KDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVR
EEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHR
AGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKLVE
EGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAK
LRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWAN
DDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVLMI
AMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIA
RKRLYEMNVVISDTAEYGNYLFSYACVPLLKPFMAELQPG
DLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGYMT
DMKRIAV
Description (1)  Ketol-acid reductoisomerase(E.C.1.1.1.86)


Functional site

1) chain A
residue 3
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 4121
source : AC1

2) chain A
residue 6
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 4121
source : AC1

3) chain A
residue 11
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 4122
source : AC2

4) chain A
residue 12
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 4122
source : AC2

5) chain A
residue 301
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 D 4124
source : AC4

6) chain A
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 4127
source : AC7

7) chain A
residue 76
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 4127
source : AC7

8) chain A
residue 78
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 4127
source : AC7

9) chain A
residue 201
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 4128
source : AC8

10) chain A
residue 202
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 4128
source : AC8

11) chain A
residue 133
type ACT_SITE
ligand
sequence G
description {ECO:0000255|HAMAP-Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI1

12) chain A
residue 218
type METAL
ligand
sequence L
description Magnesium 1. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI2

13) chain A
residue 222
type METAL
ligand
sequence Q
description Magnesium 1. {ECO:0000255|HAMAP- Rule:MF_00435}
source Swiss-Prot : SWS_FT_FI3

14) chain A
residue 218
type METAL
ligand
sequence L
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI4

15) chain A
residue 390
type METAL
ligand
sequence S
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI4

16) chain A
residue 394
type METAL
ligand
sequence L
description Magnesium 2. {ECO:0000255|HAMAP- Rule:MF_00435, ECO:0000269|PubMed:23036858}
source Swiss-Prot : SWS_FT_FI4

17) chain A
residue 79
type BINDING
ligand
sequence W
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000269|PubMed:23036858}.
source Swiss-Prot : SWS_FT_FI5

18) chain A
residue 159
type BINDING
ligand
sequence T
description NADP; via amide nitrogen. {ECO:0000255|HAMAP-Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI6

19) chain A
residue 69
type BINDING
ligand
sequence K
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000305|PubMed:9015391}.
source Swiss-Prot : SWS_FT_FI7

20) chain A
residue 415
type BINDING
ligand
sequence D
description Substrate. {ECO:0000255|HAMAP- Rule:MF_00435}.
source Swiss-Prot : SWS_FT_FI8

21) chain A
residue 77
type BINDING
ligand
sequence A
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000269|PubMed:23036858, ECO:0000305|PubMed:9015391}.
source Swiss-Prot : SWS_FT_FI9

22) chain A
residue 46-49
type NP_BIND
ligand
sequence GAQG
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000269|PubMed:23036858}.
source Swiss-Prot : SWS_FT_FI10

23) chain A
residue 109-111
type NP_BIND
ligand
sequence KQH
description NADP. {ECO:0000255|HAMAP-Rule:MF_00435, ECO:0000269|PubMed:23036858}.
source Swiss-Prot : SWS_FT_FI10

24) chain A
residue 393
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1yve
source CSA : CSA1

25) chain A
residue 383
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1yve
source CSA : CSA5


Display surface

Download
Links