eF-site ID 1yow-A PDB Code 1yow Chain A click to enlarge Title human Steroidogenic Factor 1 LBD with bound Co-factor Peptide Classification TRANSCRIPTION Compound Steroidogenic factor 1 Source null (1YOW) Sequence A:  SNVPELMLQLLQLEPDEDQVRARILGCLQEPAAFGLLCRM ADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVF DHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLV LRAQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHI LVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRA LSMQAKEYLYHKHLGNEMPRNNLLIEMLQA Description Functional site 1) chain A residue 262 type sequence F description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 2) chain A residue 265 type sequence L description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 3) chain A residue 303 type sequence S description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 4) chain A residue 306 type sequence L description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 5) chain A residue 307 type sequence V description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 6) chain A residue 310 type sequence H description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 7) chain A residue 323 type sequence I description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 8) chain A residue 331 type sequence V description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 9) chain A residue 335 type sequence T description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 10) chain A residue 336 type sequence V description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 11) chain A residue 339 type sequence Q description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 12) chain A residue 340 type sequence A description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 13) chain A residue 341 type sequence G description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 14) chain A residue 344 type sequence L description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 15) chain A residue 351 type sequence A description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 16) chain A residue 430 type sequence S description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 17) chain A residue 433 type sequence A description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 18) chain A residue 436 type sequence Y description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 19) chain A residue 440 type sequence K description BINDING SITE FOR RESIDUE P0E A 201 source : AC1 20) chain A residue 341 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P33242 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 436 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P33242 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 440 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P33242 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links