eF-site ID 1ynr-D PDB Code 1ynr Chain D click to enlarge Title Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution Classification ELECTRON TRANSPORT Compound Cytochrome c-552 Source Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) (CY552_HYDTH) Sequence D:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSI Description Functional site 1) chain D residue 6 type sequence K description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 2) chain D residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 3) chain D residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 4) chain D residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 5) chain D residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 6) chain D residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 7) chain D residue 25 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 8) chain D residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 9) chain D residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 10) chain D residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 11) chain D residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 12) chain D residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 13) chain D residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 14) chain D residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 15) chain D residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 16) chain D residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 17) chain D residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 18) chain D residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 19) chain D residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 20) chain D residue 62 type sequence Q description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 21) chain D residue 64 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 22) chain D residue 9 type sequence G description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 23) chain D residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 24) chain D residue 36 type sequence K description BINDING SITE FOR RESIDUE MPD D 605 source : BC6 25) chain D residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 26) chain D residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 27) chain D residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 28) chain D residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links