eF-site ID 1ynr-ABCD PDB Code 1ynr Chain A, B, C, D click to enlarge Title Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution Classification ELECTRON TRANSPORT Compound Cytochrome c-552 Source null (CY552_HYDTH) Sequence A:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK B:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSI C:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK D:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSI Description Functional site 1) chain A residue 7 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 2) chain A residue 8 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 3) chain B residue 6 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 4) chain C residue 20 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 5) chain B residue 47 type sequence K description BINDING SITE FOR RESIDUE SO4 B 501 source : AC2 6) chain B residue 65 type sequence T description BINDING SITE FOR RESIDUE SO4 B 501 source : AC2 7) chain B residue 66 type sequence D description BINDING SITE FOR RESIDUE SO4 B 501 source : AC2 8) chain C residue 19 type sequence K description BINDING SITE FOR RESIDUE SO4 B 501 source : AC2 9) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 10) chain C residue 7 type sequence Q description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 11) chain C residue 8 type sequence K description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 12) chain D residue 6 type sequence K description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 13) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 14) chain A residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 15) chain A residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 16) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 17) chain A residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 18) chain A residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 19) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 20) chain A residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 21) chain A residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 22) chain A residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 23) chain A residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 24) chain A residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 25) chain A residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 26) chain A residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 27) chain A residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 28) chain A residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 29) chain A residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 30) chain A residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 31) chain B residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 32) chain B residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 33) chain B residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 34) chain B residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 35) chain B residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 36) chain B residue 25 type sequence Y description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 37) chain B residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 38) chain B residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 39) chain B residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 40) chain B residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 41) chain B residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 42) chain B residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 43) chain B residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 44) chain B residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 45) chain B residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 46) chain B residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 47) chain B residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 48) chain B residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC B 81 source : AC5 49) chain C residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 50) chain C residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 51) chain C residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 52) chain C residue 21 type sequence V description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 53) chain C residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 54) chain C residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 55) chain C residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 56) chain C residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 57) chain C residue 42 type sequence L description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 58) chain C residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 59) chain C residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 60) chain C residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 61) chain C residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 62) chain C residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 63) chain C residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 64) chain C residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 65) chain C residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 66) chain C residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 67) chain C residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC C 81 source : AC6 68) chain D residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 69) chain D residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 70) chain D residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 71) chain D residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 72) chain D residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 73) chain D residue 25 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 74) chain D residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 75) chain D residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 76) chain D residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 77) chain D residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 78) chain D residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 79) chain D residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 80) chain D residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 81) chain D residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 82) chain D residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 83) chain D residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 84) chain D residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 85) chain D residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 86) chain D residue 62 type sequence Q description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 87) chain D residue 64 type sequence V description BINDING SITE FOR RESIDUE HEC D 81 source : AC7 88) chain A residue 19 type sequence K description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 89) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 90) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 91) chain A residue 22 type sequence G description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 92) chain A residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 93) chain C residue 63 type sequence N description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 94) chain D residue 9 type sequence G description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 95) chain D residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 96) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 97) chain A residue 35 type sequence R description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 98) chain A residue 37 type sequence D description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 99) chain B residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD B 602 source : BC2 100) chain C residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD B 602 source : BC2 101) chain C residue 13 type sequence C description BINDING SITE FOR RESIDUE MPD B 602 source : BC2 102) chain B residue 32 type sequence Y description BINDING SITE FOR RESIDUE MPD B 607 source : BC3 103) chain B residue 35 type sequence R description BINDING SITE FOR RESIDUE MPD B 607 source : BC3 104) chain B residue 36 type sequence K description BINDING SITE FOR RESIDUE MPD B 607 source : BC3 105) chain B residue 38 type sequence A description BINDING SITE FOR RESIDUE MPD B 607 source : BC3 106) chain B residue 41 type sequence Y description BINDING SITE FOR RESIDUE MPD B 607 source : BC3 107) chain B residue 63 type sequence N description BINDING SITE FOR RESIDUE MPD C 604 source : BC4 108) chain C residue 20 type sequence K description BINDING SITE FOR RESIDUE MPD C 604 source : BC4 109) chain C residue 35 type sequence R description BINDING SITE FOR RESIDUE MPD C 608 source : BC5 110) chain C residue 41 type sequence Y description BINDING SITE FOR RESIDUE MPD C 608 source : BC5 111) chain D residue 36 type sequence K description BINDING SITE FOR RESIDUE MPD D 605 source : BC6 112) chain B residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 113) chain B residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 114) chain C residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 115) chain C residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 116) chain D residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 117) chain D residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 118) chain A residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 119) chain A residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 120) chain B residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 121) chain B residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 122) chain C residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 123) chain C residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 124) chain D residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 125) chain D residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 126) chain A residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 127) chain A residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links