eF-site ID 1ynr-A PDB Code 1ynr Chain A click to enlarge Title Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution Classification ELECTRON TRANSPORT Compound Cytochrome c-552 Source Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) (CY552_HYDTH) Sequence A:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK Description Functional site 1) chain A residue 7 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 2) chain A residue 8 type sequence K description BINDING SITE FOR RESIDUE SO4 A 502 source : AC1 3) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE SO4 C 503 source : AC3 4) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 5) chain A residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 6) chain A residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 7) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 8) chain A residue 22 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 9) chain A residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 10) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 11) chain A residue 41 type sequence Y description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 12) chain A residue 45 type sequence K description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 13) chain A residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 14) chain A residue 50 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 15) chain A residue 51 type sequence S description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 16) chain A residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 17) chain A residue 53 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 18) chain A residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 19) chain A residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 20) chain A residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 21) chain A residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC A 81 source : AC4 22) chain A residue 19 type sequence K description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 23) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 24) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 25) chain A residue 22 type sequence G description BINDING SITE FOR RESIDUE MPD A 601 source : AC8 26) chain A residue 12 type sequence A description BINDING SITE FOR RESIDUE MPD A 603 source : AC9 27) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 28) chain A residue 35 type sequence R description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 29) chain A residue 37 type sequence D description BINDING SITE FOR RESIDUE MPD A 606 source : BC1 30) chain A residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 31) chain A residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 32) chain A residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 33) chain A residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links