eF-site ID 1yhn-A PDB Code 1yhn Chain A click to enlarge Title Structure basis of RILP recruitment by Rab7 Classification PROTEIN TRANSPORT Compound Ras-related protein Rab-7 Source Homo sapiens (Human) (RAB7_HUMAN) Sequence A:  SRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIG ADFLTKEVMVDDRLVTMQIWDTAGLERFQSLGVAFYRGAD CCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVV LGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINV EQAFQTIARNALKQETEVELYNE Description Functional site 1) chain A residue 22 type sequence T description BINDING SITE FOR RESIDUE MG A 302 source : AC1 2) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE MG A 302 source : AC1 3) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE MG A 302 source : AC1 4) chain A residue 64 type sequence T description BINDING SITE FOR RESIDUE MG A 302 source : AC1 5) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 6) chain A residue 18 type sequence G description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 7) chain A residue 19 type sequence V description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 8) chain A residue 20 type sequence G description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 9) chain A residue 21 type sequence K description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 10) chain A residue 22 type sequence T description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 11) chain A residue 23 type sequence S description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 12) chain A residue 33 type sequence F description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 13) chain A residue 34 type sequence S description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 14) chain A residue 35 type sequence N description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 15) chain A residue 37 type sequence Y description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 16) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 17) chain A residue 64 type sequence T description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 18) chain A residue 65 type sequence A description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 19) chain A residue 66 type sequence G description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 20) chain A residue 125 type sequence N description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 21) chain A residue 126 type sequence K description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 22) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 23) chain A residue 129 type sequence L description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 24) chain A residue 155 type sequence S description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 25) chain A residue 156 type sequence A description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 26) chain A residue 157 type sequence K description BINDING SITE FOR RESIDUE GTP A 301 source : AC2 27) chain A residue 15 type BINDING sequence G description BINDING => ECO:0000269|PubMed:15933719, ECO:0000269|PubMed:20028791 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 34 type BINDING sequence S description BINDING => ECO:0000269|PubMed:15933719, ECO:0000269|PubMed:20028791 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 63 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15933719, ECO:0000269|PubMed:20028791 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 125 type BINDING sequence N description BINDING => ECO:0000269|PubMed:15933719, ECO:0000269|PubMed:20028791 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 156 type BINDING sequence A description BINDING => ECO:0000269|PubMed:15933719, ECO:0000269|PubMed:20028791 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 72 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 33) chain A residue 11-24 type prosite sequence VIILGDSGVGKTSL description SIGMA54_INTERACT_1 Sigma-54 interaction domain ATP-binding region A signature. VIIlGDSGVGKtsL source prosite : PS00675

Display surface Download Links