eF-site ID 1yf2-A
PDB Code 1yf2
Chain A

click to enlarge
Title Three-dimensional structure of DNA sequence specificity (S) subunit of a type I restriction-modification enzyme and its functional implications
Classification HYDROLASE REGULATOR
Compound Type I restriction-modification enzyme, S subunit
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y130_METJA)
Sequence A:  MFYKEENFKKTEIGEIPEDWEIVELKDVCKKIKAGGTPKT
SVEEYYKNGTIPFVKIEDITNSNKYLTNTKIKITEEGLNN
SNAWIVPKNSVLFAMYGSIGETAINKIEVATNQAILGIIP
KDNILESEFLYYILAKNKNYYSKLGMQTTQKNLNAQIVKS
FKIPLPPLEEQKQIAKILTKIDEGIEIIEKSINKLERIKK
GLMHKLLTKGIGHSRFKKSEIGEIPEDWEVFEIKDIFEVK
TGTTPSTKKSEYWENGEINWITPLDLSRLNEKIYIGSSER
KVTKIALEKCNLNLIPKGSIIISTRAPVGYVAVLTVESTF
NQGCKGLFQKNNDSVNTEFYAYYLKFKKNLLENLSGGSTF
KELSKSMLENFKIPLPPLEEQKQIAKILSSVDKSIELKKQ
KKEKLQRMKKKIMELLLTGKVRVKT
Description (1)  Type I restriction-modification enzyme, S subunit

Display surface

Download
Links