eF-site ID 1yce-v PDB Code 1yce Chain v click to enlarge Title Structure of the rotor ring of F-type Na+-ATPase from Ilyobacter tartaricus Classification MEMBRANE PROTEIN Compound subunit c Source ORGANISM_SCIENTIFIC: Ilyobacter tartaricus; Sequence v:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain v residue 63 type sequence V description BINDING SITE FOR RESIDUE NA l 201 source : DC7 2) chain v residue 64 type sequence A description BINDING SITE FOR RESIDUE NA l 201 source : DC7 3) chain v residue 66 type sequence S description BINDING SITE FOR RESIDUE NA l 201 source : DC7 4) chain v residue 67 type sequence T description BINDING SITE FOR RESIDUE NA l 201 source : DC7 5) chain v residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA v 201 source : EC8 6) chain v residue 65 type sequence E description BINDING SITE FOR RESIDUE NA v 201 source : EC8 7) chain v residue 5 type sequence F description BINDING SITE FOR RESIDUE F09 v 314 source : GC3 8) chain v residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 9) chain v residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 10) chain v residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 11) chain v residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 12) chain v residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 13) chain v residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4

Display surface Download Links