eF-site ID 1yce-o PDB Code 1yce Chain o click to enlarge Title Structure of the rotor ring of F-type Na+-ATPase from Ilyobacter tartaricus Classification MEMBRANE PROTEIN Compound subunit c Source ORGANISM_SCIENTIFIC: Ilyobacter tartaricus; Sequence o:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain o residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA o 201 source : EC1 2) chain o residue 65 type sequence E description BINDING SITE FOR RESIDUE NA o 201 source : EC1 3) chain o residue 63 type sequence V description BINDING SITE FOR RESIDUE NA p 201 source : EC2 4) chain o residue 64 type sequence A description BINDING SITE FOR RESIDUE NA p 201 source : EC2 5) chain o residue 66 type sequence S description BINDING SITE FOR RESIDUE NA p 201 source : EC2 6) chain o residue 13 type sequence A description BINDING SITE FOR RESIDUE F09 n 314 source : FC9 7) chain o residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 8) chain o residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 9) chain o residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 10) chain o residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4 11) chain o residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 12) chain o residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links