eF-site ID 1yce-P PDB Code 1yce Chain P click to enlarge Title Structure of the rotor ring of F-type Na+-ATPase from Ilyobacter tartaricus Classification MEMBRANE PROTEIN Compound subunit c Source ORGANISM_SCIENTIFIC: Ilyobacter tartaricus; Sequence P:  MDMLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAV ESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY ANPFVGLLG Description Functional site 1) chain P residue 32 type sequence Q description BINDING SITE FOR RESIDUE NA P 201 source : BC7 2) chain P residue 65 type sequence E description BINDING SITE FOR RESIDUE NA P 201 source : BC7 3) chain P residue 63 type sequence V description BINDING SITE FOR RESIDUE NA Q 201 source : BC8 4) chain P residue 66 type sequence S description BINDING SITE FOR RESIDUE NA Q 201 source : BC8 5) chain P residue 5 type sequence F description BINDING SITE FOR RESIDUE F09 O 314 source : FC3 6) chain P residue 9-29 type TRANSMEM sequence VVLAASAVGAGTAMIAGIGPG description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 7) chain P residue 68-88 type TRANSMEM sequence GIYSLVIALILLYANPFVGLL description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 8) chain P residue 1-8 type TOPO_DOM sequence MDMLFAKT description Periplasmic source Swiss-Prot : SWS_FT_FI1 9) chain P residue 89 type TOPO_DOM sequence G description Periplasmic source Swiss-Prot : SWS_FT_FI1 10) chain P residue 30-67 type TOPO_DOM sequence VGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAEST description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 11) chain P residue 65 type SITE sequence E description Reversibly binds sodium during transport source Swiss-Prot : SWS_FT_FI4

Display surface Download Links